PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00322.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 333aa    MW: 37697.1 Da    PI: 7.9179
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00322.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.3e-161462148
                             TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                             +g+W++eEd +l+d++ ++G+g +W + ++++g++R++k+c++rw++yl
  Rsa1.0_00322.1_g00004.1 14 KGPWSPEEDVKLKDYIDKYGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                             79*********************************************97 PP

2Myb_DNA-binding38.33.2e-1269111246
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              g +++eEd +++ +    G++ W+ Ia+ ++ gRt++++k++w++
  Rsa1.0_00322.1_g00004.1  69 GGFSEEEDSIILSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                              569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.519962IPR017930Myb domain
SuperFamilySSF466896.53E-2711109IPR009057Homeodomain-like
SMARTSM007172.6E-121364IPR001005SANT/Myb domain
PfamPF002492.8E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.9E-241569IPR009057Homeodomain-like
CDDcd001677.28E-91662No hitNo description
PROSITE profilePS5129421.34963117IPR017930Myb domain
SMARTSM007171.5E-1167115IPR001005SANT/Myb domain
PfamPF002497.7E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.4E-2370117IPR009057Homeodomain-like
CDDcd001672.68E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0035987Biological Processendodermal cell differentiation
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000021Biological Processregulation of ion homeostasis
GO:2000067Biological Processregulation of root morphogenesis
GO:0048226Cellular ComponentCasparian strip
GO:0000975Molecular Functionregulatory region DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDVKLKDYID KYGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDSIIL SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLLGR  120
QKQMTRQDSI ADSNESNINN NNKSPQNLSS SALERLQLHM QLQNLQSPFS SFYNNPILWP  180
KLHPLLQSTT TTPDQNSKLG SQECFHPRGA NVVHQNNNIK LAGINDGVSP FYSENVEQSL  240
NPTHGFQPNF GFSQDFQQDN HNMDLMNRGG SKELFQVGNE FELTNGSSWW SEEVELEKKT  300
TSSSSWGSTS VLDQTTEGMV MLQDYAQMSY HSV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0628780.0AF062878.1 Arabidopsis thaliana putative transcription factor (MYB36) mRNA, complete cds.
GenBankAY5196400.0AY519640.1 Arabidopsis thaliana MYB transcription factor (At5g57620) mRNA, complete cds.
GenBankBT0303310.0BT030331.1 Arabidopsis thaliana unknown protein (At5g57620) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013627144.10.0PREDICTED: transcription factor RAX3
RefseqXP_013681714.10.0PREDICTED: transcription factor RAX3-like
SwissprotQ9FKL20.0MYB36_ARATH; Transcription factor MYB36
TrEMBLA0A078FBT40.0A0A078FBT4_BRANA; BnaC03g12860D protein
TrEMBLA0A0D3B2Z30.0A0A0D3B2Z3_BRAOL; Uncharacterized protein
STRINGBra006811.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78982639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.10.0myb domain protein 36